Lineage for d1rf8b_ (1rf8 B:)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 651129Fold a.210: Eukaryotic initiation factor 4f subunit eIF4g, eIF4e-binding domain [101488] (1 superfamily)
    5 helices, non-globular array; wraps around the N-terminal tail of its target
  4. 651130Superfamily a.210.1: Eukaryotic initiation factor 4f subunit eIF4g, eIF4e-binding domain [101489] (1 family) (S)
    not a true superfamily
  5. 651131Family a.210.1.1: Eukaryotic initiation factor 4f subunit eIF4g, eIF4e-binding domain [101490] (1 protein)
  6. 651132Protein Eukaryotic initiation factor 4f subunit eIF4g, eIF4e-binding domain [101491] (1 species)
  7. 651133Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [101492] (1 PDB entry)
  8. 651134Domain d1rf8b_: 1rf8 B: [97371]
    Other proteins in same PDB: d1rf8a_
    complexed with m7g, mtn

Details for d1rf8b_

PDB Entry: 1rf8 (more details)

PDB Description: Solution structure of the yeast translation initiation factor eIF4E in complex with m7GDP and eIF4GI residues 393 to 490
PDB Compounds: (B:) Eukaryotic initiation factor 4F subunit p150

SCOP Domain Sequences for d1rf8b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rf8b_ a.210.1.1 (B:) Eukaryotic initiation factor 4f subunit eIF4g, eIF4e-binding domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
gsigleaeietttdetddgtntvshilnvlkdatpiedvfsfnypegiegpdikykkehv
kytygptfllqfkdklnvkadaewvqstaskivippgmgr

SCOP Domain Coordinates for d1rf8b_:

Click to download the PDB-style file with coordinates for d1rf8b_.
(The format of our PDB-style files is described here.)

Timeline for d1rf8b_: