![]() | Class a: All alpha proteins [46456] (258 folds) |
![]() | Fold a.210: Eukaryotic initiation factor 4f subunit eIF4g, eIF4e-binding domain [101488] (1 superfamily) 5 helices, non-globular array; wraps around the N-terminal tail of its target |
![]() | Superfamily a.210.1: Eukaryotic initiation factor 4f subunit eIF4g, eIF4e-binding domain [101489] (1 family) ![]() not a true superfamily |
![]() | Family a.210.1.1: Eukaryotic initiation factor 4f subunit eIF4g, eIF4e-binding domain [101490] (1 protein) |
![]() | Protein Eukaryotic initiation factor 4f subunit eIF4g, eIF4e-binding domain [101491] (1 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [101492] (1 PDB entry) |
![]() | Domain d1rf8b_: 1rf8 B: [97371] Other proteins in same PDB: d1rf8a_ complexed with m7g, mtn |
PDB Entry: 1rf8 (more details)
SCOP Domain Sequences for d1rf8b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rf8b_ a.210.1.1 (B:) Eukaryotic initiation factor 4f subunit eIF4g, eIF4e-binding domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} gsigleaeietttdetddgtntvshilnvlkdatpiedvfsfnypegiegpdikykkehv kytygptfllqfkdklnvkadaewvqstaskivippgmgr
Timeline for d1rf8b_: