![]() | Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
![]() | Fold d.86: eIF4e-like [55417] (1 superfamily) beta(2)-alpha-beta(2)-alpha-beta(2)-alpha-beta-2; 2 layers: alpha/beta; antiparallel sheet: 21356478 |
![]() | Superfamily d.86.1: eIF4e-like [55418] (2 families) ![]() |
![]() | Family d.86.1.1: Translation initiation factor eIF4e [55419] (1 protein) |
![]() | Protein Translation initiation factor eIF4e [55420] (2 species) messenger RNA 5' cap-binding protein |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55422] (2 PDB entries) |
![]() | Domain d1rf8a_: 1rf8 A: [97370] Other proteins in same PDB: d1rf8b_ complexed with eIF4g fragment complexed with m7g, mtn |
PDB Entry: 1rf8 (more details)
SCOP Domain Sequences for d1rf8a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rf8a_ d.86.1.1 (A:) Translation initiation factor eIF4e {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} msveevskkfeenvsvddttatpktvlsdsahfdvkhplntkwtlwytkpavdkseswsd llrpvtsfqtveefwaiiqnipephelplksdyhvfrndvrpewedeanakggkwsfqlc gkgadidelwlctllavigetideddsqingvvlsirkggnkfalwtkcedkepllrigg kfkqvlkltddghleffphcsangrhpqpsitl
Timeline for d1rf8a_: