SCOP 1.69: Domain d1rf8a_: 1rf8 A:

Lineage for d1rf8a_ (1rf8 A:)

1. Root: SCOP 1.69

2. Class d: Alpha and beta proteins (a+b) [53931] (279 folds)

3. Fold d.86: Translation initiation factor eIF4e [55417] (1 superfamily)
   beta(2)-alpha-beta(2)-alpha-beta(2)-alpha-beta-2; 2 layers: alpha/beta; antiparallel sheet: 21356478

4. Superfamily d.86.1: Translation initiation factor eIF4e [55418] (1 family)

5. Family d.86.1.1: Translation initiation factor eIF4e [55419] (1 protein)

6. Protein Translation initiation factor eIF4e [55420] (2 species)
   messenger RNA 5' cap-binding protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55422] (2 PDB entries)

8. Domain d1rf8a_: 1rf8 A: [97370]
   Other proteins in same PDB: d1rf8b_
   complexed with eIF4g fragment

Details for d1rf8a_

PDB Entry: 1rf8

PDB Description: Solution structure of the yeast translation initiation factor eIF4E in complex with m7GDP and eIF4GI residues 393 to 490

SCOP Domain Sequences for d1rf8a_:

Sequence; same for both SEQRES and ATOM records:

>d1rf8a_ d.86.1.1 (A:) Translation initiation factor eIF4e {Baker's yeast (Saccharomyces cerevisiae)}
msveevskkfeenvsvddttatpktvlsdsahfdvkhplntkwtlwytkpavdkseswsd
llrpvtsfqtveefwaiiqnipephelplksdyhvfrndvrpewedeanakggkwsfqlc
gkgadidelwlctllavigetideddsqingvvlsirkggnkfalwtkcedkepllrigg
kfkqvlkltddghleffphcsangrhpqpsitl

Timeline for d1rf8a_:

• d1rf8a_ first appeared in SCOP 1.67
  
• d1rf8a_ appears in SCOP 1.71
  
• d1rf8a_ appears in the current release, SCOPe 2.08