Lineage for d1rf8a_ (1rf8 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2962641Fold d.86: eIF4e-like [55417] (1 superfamily)
    beta(2)-alpha-beta(2)-alpha-beta(2)-alpha-beta-2; 2 layers: alpha/beta; antiparallel sheet: 21356478
  4. 2962642Superfamily d.86.1: eIF4e-like [55418] (3 families) (S)
  5. 2962643Family d.86.1.1: Translation initiation factor eIF4e [55419] (1 protein)
    automatically mapped to Pfam PF01652
  6. 2962644Protein Translation initiation factor eIF4e [55420] (3 species)
    messenger RNA 5' cap-binding protein
  7. 2962645Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55422] (2 PDB entries)
  8. 2962646Domain d1rf8a_: 1rf8 A: [97370]
    Other proteins in same PDB: d1rf8b1, d1rf8b2
    complexed with eIF4g fragment
    complexed with m7g, mtn

Details for d1rf8a_

PDB Entry: 1rf8 (more details)

PDB Description: Solution structure of the yeast translation initiation factor eIF4E in complex with m7GDP and eIF4GI residues 393 to 490
PDB Compounds: (A:) eukaryotic translation initiation factor 4e

SCOPe Domain Sequences for d1rf8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rf8a_ d.86.1.1 (A:) Translation initiation factor eIF4e {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
msveevskkfeenvsvddttatpktvlsdsahfdvkhplntkwtlwytkpavdkseswsd
llrpvtsfqtveefwaiiqnipephelplksdyhvfrndvrpewedeanakggkwsfqlc
gkgadidelwlctllavigetideddsqingvvlsirkggnkfalwtkcedkepllrigg
kfkqvlkltddghleffphcsangrhpqpsitl

SCOPe Domain Coordinates for d1rf8a_:

Click to download the PDB-style file with coordinates for d1rf8a_.
(The format of our PDB-style files is described here.)

Timeline for d1rf8a_: