Lineage for d1rf6b_ (1rf6 B:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2199715Fold d.68: IF3-like [55199] (8 superfamilies)
    beta-alpha-beta-alpha-beta(2); 2 layers; mixed sheet 1243, strand 4 is antiparallel to the rest
  4. 2199729Superfamily d.68.2: EPT/RTPC-like [55205] (3 families) (S)
  5. 2199739Family d.68.2.2: Enolpyruvate transferase, EPT [55209] (3 proteins)
    duplication: 6 repeats of this fold are organized in two RPTC-like domains
    automatically mapped to Pfam PF00275
  6. 2199740Protein 5-enol-pyruvyl shikimate-3-phosphate (EPSP) synthase [55213] (4 species)
  7. 2199767Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [103061] (3 PDB entries)
  8. 2199769Domain d1rf6b_: 1rf6 B: [97367]
    complexed with gpj, s3p

Details for d1rf6b_

PDB Entry: 1rf6 (more details), 1.9 Å

PDB Description: Structural Studies of Streptococcus pneumoniae EPSP Synthase in S3P-GLP Bound State
PDB Compounds: (B:) 5-enolpyruvylshikimate-3-phosphate synthase

SCOPe Domain Sequences for d1rf6b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rf6b_ d.68.2.2 (B:) 5-enol-pyruvyl shikimate-3-phosphate (EPSP) synthase {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
mklktnirhlhgiirvpgdksishrsiifgslaegetkvydilrgedvlstmqvfrdlgv
eiedkdgvitvqgvgmaglkapqnalnmgnsgtsirlisgvlagadfevemfgddslskr
pmdrvtlplkkmgvsisgqterdlpplrlkgtknlrpihyelpiasaqvksalmfaalqa
kgesviiekeytrnhtedmlqqfgghlsvdgkkitvqgpqkltgqkvvvpgdissaafwl
vagliapnsrlvlqnvginetrtgiidviramggkleiteidpvaksatlivessdlkgt
eicgaliprlidelpiiallatqaqgvtvikdaeelkvketdriqvvadalnsmgaditp
tadgmiikgksalhgarvntfgdhrigmmtaiaallvadgeveldraeaintsypsffdd
leslihg

SCOPe Domain Coordinates for d1rf6b_:

Click to download the PDB-style file with coordinates for d1rf6b_.
(The format of our PDB-style files is described here.)

Timeline for d1rf6b_: