SCOPe 2.07: Domain d1rf1f2: 1rf1 F:103-141

Lineage for d1rf1f2 (1rf1 F:103-141)

1. Root: SCOPe 2.07

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.1: Parallel coiled-coil [57943] (41 superfamilies)
   this is not a true fold; includes oligomers of shorter identical helices

4. Superfamily h.1.8: Fibrinogen coiled-coil and central regions [58010] (2 families)

5. Family h.1.8.1: Fibrinogen coiled-coil and central regions [58011] (3 proteins)
   in the central region two triple coiled-coils are stacked end-to-end and interlock with N-terminal tails

6. Protein Fibrinogen gamma chain [88898] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88900] (18 PDB entries)
   Uniprot P02679

8. Domain d1rf1f2: 1rf1 F:103-141 [97357]
   Other proteins in same PDB: d1rf1a_, d1rf1b1, d1rf1b2, d1rf1c1, d1rf1d_, d1rf1e1, d1rf1e2, d1rf1f1
   coiled-coil region only
   complexed with ca

Details for d1rf1f2

PDB Entry: 1rf1, 2.53 Å

PDB Description: crystal structure of fragment d of gammae132a fibrinogen with the peptide ligand gly-his-arg-pro-amide

PDB Compounds: (F:) Fibrinogen gamma chain

SCOPe Domain Sequences for d1rf1f2:

Sequence; same for both SEQRES and ATOM records:

>d1rf1f2 h.1.8.1 (F:103-141) Fibrinogen gamma chain {Human (Homo sapiens) [TaxId: 9606]}
hdssirylqeiynsnnqkivnlkekvaqlaaqcqepckd

Timeline for d1rf1f2:

• d1rf1f2 first appeared in SCOP 1.67
  
• d1rf1f2 appears in SCOPe 2.06
  
• d1rf1f2 appears in the current release, SCOPe 2.08