Lineage for d1rf1c2 (1rf1 C:96-141)

  1. Root: SCOP 1.67
  2. 431023Class h: Coiled coil proteins [57942] (6 folds)
  3. 431024Fold h.1: Parallel coiled-coil [57943] (27 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 431436Superfamily h.1.8: Fibrinogen coiled-coil and central regions [58010] (1 family) (S)
  5. 431437Family h.1.8.1: Fibrinogen coiled-coil and central regions [58011] (3 proteins)
    in the central region two triple coiled-coils are stacked end-to-end and interlock with N-terminal tails
  6. 431524Protein Fibrinogen gamma chain [88898] (4 species)
  7. 431533Species Human (Homo sapiens) [TaxId:9606] [88900] (13 PDB entries)
  8. 431536Domain d1rf1c2: 1rf1 C:96-141 [97352]
    Other proteins in same PDB: d1rf1a_, d1rf1b1, d1rf1b2, d1rf1c1, d1rf1d_, d1rf1e1, d1rf1e2, d1rf1f1

Details for d1rf1c2

PDB Entry: 1rf1 (more details), 2.53 Å

PDB Description: crystal structure of fragment d of gammae132a fibrinogen with the peptide ligand gly-his-arg-pro-amide

SCOP Domain Sequences for d1rf1c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rf1c2 h.1.8.1 (C:96-141) Fibrinogen gamma chain {Human (Homo sapiens)}
yeasilthdssirylqeiynsnnqkivnlkekvaqlaaqcqepckd

SCOP Domain Coordinates for d1rf1c2:

Click to download the PDB-style file with coordinates for d1rf1c2.
(The format of our PDB-style files is described here.)

Timeline for d1rf1c2: