Lineage for d1rewd_ (1rew D:)

  1. Root: SCOPe 2.01
  2. 1061255Class g: Small proteins [56992] (90 folds)
  3. 1062938Fold g.7: Snake toxin-like [57301] (1 superfamily)
    disulfide-rich fold: nearly all-beta
  4. 1062939Superfamily g.7.1: Snake toxin-like [57302] (4 families) (S)
  5. 1063138Family g.7.1.3: Extracellular domain of cell surface receptors [57354] (7 proteins)
  6. 1063139Protein BMP receptor Ia ectodomain [57359] (1 species)
  7. 1063140Species Human (Homo sapiens) [TaxId:9606] [57360] (5 PDB entries)
  8. 1063144Domain d1rewd_: 1rew D: [97337]
    Other proteins in same PDB: d1rewa_, d1rewb_

Details for d1rewd_

PDB Entry: 1rew (more details), 1.86 Å

PDB Description: structural refinement of the complex of bone morphogenetic protein 2 and its type ia receptor
PDB Compounds: (D:) Bone morphogenetic protein receptor type IA

SCOPe Domain Sequences for d1rewd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rewd_ g.7.1.3 (D:) BMP receptor Ia ectodomain {Human (Homo sapiens) [TaxId: 9606]}
tlpflkcycsghcpddainntcitnghcfaiieeddqgettlasgcmkyegsdfqckdsp
kaqlrrtieccrtnlcnqylqptlppvvi

SCOPe Domain Coordinates for d1rewd_:

Click to download the PDB-style file with coordinates for d1rewd_.
(The format of our PDB-style files is described here.)

Timeline for d1rewd_: