![]() | Class g: Small proteins [56992] (90 folds) |
![]() | Fold g.7: Snake toxin-like [57301] (1 superfamily) disulfide-rich fold: nearly all-beta |
![]() | Superfamily g.7.1: Snake toxin-like [57302] (4 families) ![]() |
![]() | Family g.7.1.3: Extracellular domain of cell surface receptors [57354] (5 proteins) |
![]() | Protein BMP receptor Ia ectodomain [57359] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [57360] (5 PDB entries) |
![]() | Domain d1rewc_: 1rew C: [97336] Other proteins in same PDB: d1rewa_, d1rewb_ |
PDB Entry: 1rew (more details), 1.86 Å
SCOPe Domain Sequences for d1rewc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rewc_ g.7.1.3 (C:) BMP receptor Ia ectodomain {Human (Homo sapiens) [TaxId: 9606]} tlpflkcycsghcpddainntcitnghcfaiieeddqgettlasgcmkyegsdfqckdsp kaqlrrtieccrtnlcnqylqptlpp
Timeline for d1rewc_: