Lineage for d1rewc_ (1rew C:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3032122Fold g.7: Snake toxin-like [57301] (1 superfamily)
    disulfide-rich fold: nearly all-beta
  4. 3032123Superfamily g.7.1: Snake toxin-like [57302] (4 families) (S)
  5. 3032361Family g.7.1.3: Extracellular domain of cell surface receptors [57354] (6 proteins)
  6. 3032362Protein BMP receptor Ia ectodomain [57359] (1 species)
  7. 3032363Species Human (Homo sapiens) [TaxId:9606] [57360] (11 PDB entries)
  8. 3032366Domain d1rewc_: 1rew C: [97336]
    Other proteins in same PDB: d1rewa_, d1rewb_

Details for d1rewc_

PDB Entry: 1rew (more details), 1.86 Å

PDB Description: structural refinement of the complex of bone morphogenetic protein 2 and its type ia receptor
PDB Compounds: (C:) Bone morphogenetic protein receptor type IA

SCOPe Domain Sequences for d1rewc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rewc_ g.7.1.3 (C:) BMP receptor Ia ectodomain {Human (Homo sapiens) [TaxId: 9606]}
tlpflkcycsghcpddainntcitnghcfaiieeddqgettlasgcmkyegsdfqckdsp
kaqlrrtieccrtnlcnqylqptlpp

SCOPe Domain Coordinates for d1rewc_:

Click to download the PDB-style file with coordinates for d1rewc_.
(The format of our PDB-style files is described here.)

Timeline for d1rewc_: