Class g: Small proteins [56992] (90 folds) |
Fold g.17: Cystine-knot cytokines [57500] (1 superfamily) disulfide-rich fold; common core is all-beta |
Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families) |
Family g.17.1.2: Transforming growth factor (TGF)-beta [57507] (8 proteins) |
Protein Bone morphogenetic protein-2 (BMP-2) [57516] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [57517] (10 PDB entries) |
Domain d1reua_: 1reu A: [97333] complexed with mpd; mutant |
PDB Entry: 1reu (more details), 2.65 Å
SCOPe Domain Sequences for d1reua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1reua_ g.17.1.2 (A:) Bone morphogenetic protein-2 (BMP-2) {Human (Homo sapiens) [TaxId: 9606]} ssckrhplyvdfsdvgwndwivappgyhafychgecpfppadhlnstnhaivqtlvnsvn skipkaccvptelsaismlyldenekvvlknyqdmvvegcgcr
Timeline for d1reua_: