Lineage for d1reua_ (1reu A:)

  1. Root: SCOP 1.67
  2. 427008Class g: Small proteins [56992] (72 folds)
  3. 429052Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
    disulfide-rich fold; common core is all-beta
  4. 429053Superfamily g.17.1: Cystine-knot cytokines [57501] (7 families) (S)
  5. 429102Family g.17.1.2: Transforming growth factor (TGF)-beta [57507] (7 proteins)
  6. 429109Protein Bone morphogenetic protein-2 (BMP-2) [57516] (1 species)
  7. 429110Species Human (Homo sapiens) [TaxId:9606] [57517] (4 PDB entries)
  8. 429113Domain d1reua_: 1reu A: [97333]
    complexed with mpd; mutant

Details for d1reua_

PDB Entry: 1reu (more details), 2.65 Å

PDB Description: structure of the bone morphogenetic protein 2 mutant l51p

SCOP Domain Sequences for d1reua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1reua_ g.17.1.2 (A:) Bone morphogenetic protein-2 (BMP-2) {Human (Homo sapiens)}
ssckrhplyvdfsdvgwndwivappgyhafychgecpfppadhlnstnhaivqtlvnsvn
skipkaccvptelsaismlyldenekvvlknyqdmvvegcgcr

SCOP Domain Coordinates for d1reua_:

Click to download the PDB-style file with coordinates for d1reua_.
(The format of our PDB-style files is described here.)

Timeline for d1reua_: