Lineage for d1rerc2 (1rer C:1-292)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2628446Fold f.10: Viral glycoprotein, central and dimerisation domains [56982] (1 superfamily)
    2 intertwined domains; all-beta and alpha+beta
  4. 2628447Superfamily f.10.1: Viral glycoprotein, central and dimerisation domains [56983] (2 families) (S)
  5. 2628448Family f.10.1.1: Viral glycoprotein, central and dimerisation domains [56984] (3 proteins)
  6. 2628476Protein Fusion glycoprotein E1 [75656] (1 species)
  7. 2628477Species Semliki forest virus [TaxId:11033] [75657] (2 PDB entries)
  8. 2628480Domain d1rerc2: 1rer C:1-292 [97332]
    Other proteins in same PDB: d1rera1, d1rerb1, d1rerc1
    complexed with br, ho, po4

Details for d1rerc2

PDB Entry: 1rer (more details), 3.2 Å

PDB Description: crystal structure of the homotrimer of fusion glycoprotein e1 from semliki forest virus.
PDB Compounds: (C:) Structural polyprotein

SCOPe Domain Sequences for d1rerc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rerc2 f.10.1.1 (C:1-292) Fusion glycoprotein E1 {Semliki forest virus [TaxId: 11033]}
yehstvmpnvvgfpykahierpgyspltlqmqvvetsleptlnleyitceyktvvpspyv
kccgasecstkekpdyqckvytgvypfmwggaycfcdsentqlseayvdrsdvcrhdhas
aykahtaslkakvrvmygnvnqtvdvyvngdhavtiggtqfifgplssawtpfdnkivvy
kdevfnqdfppygsgqpgrfgdiqsrtvesndlyantalklarpspgmvhvpytqtpsgf
kywlkekgtalntkapfgcqiktnpvramncavgnipvsmnlpdsaftrive

SCOPe Domain Coordinates for d1rerc2:

Click to download the PDB-style file with coordinates for d1rerc2.
(The format of our PDB-style files is described here.)

Timeline for d1rerc2: