Lineage for d1rerc2 (1rer C:1-292)

  1. Root: SCOP 1.75
  2. 886031Class f: Membrane and cell surface proteins and peptides [56835] (58 folds)
  3. 886497Fold f.10: Viral glycoprotein, central and dimerisation domains [56982] (1 superfamily)
    2 intertwined domains; all-beta and alpha+beta
  4. 886498Superfamily f.10.1: Viral glycoprotein, central and dimerisation domains [56983] (1 family) (S)
  5. 886499Family f.10.1.1: Viral glycoprotein, central and dimerisation domains [56984] (2 proteins)
  6. 886525Protein Fusion glycoprotein E1 [75656] (1 species)
  7. 886526Species Semliki forest virus [TaxId:11033] [75657] (3 PDB entries)
  8. 886531Domain d1rerc2: 1rer C:1-292 [97332]
    Other proteins in same PDB: d1rera1, d1rerb1, d1rerc1
    complexed with br, fuc, ho, man, nag, po4

Details for d1rerc2

PDB Entry: 1rer (more details), 3.2 Å

PDB Description: crystal structure of the homotrimer of fusion glycoprotein e1 from semliki forest virus.
PDB Compounds: (C:) Structural polyprotein

SCOP Domain Sequences for d1rerc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rerc2 f.10.1.1 (C:1-292) Fusion glycoprotein E1 {Semliki forest virus [TaxId: 11033]}
yehstvmpnvvgfpykahierpgyspltlqmqvvetsleptlnleyitceyktvvpspyv
kccgasecstkekpdyqckvytgvypfmwggaycfcdsentqlseayvdrsdvcrhdhas
aykahtaslkakvrvmygnvnqtvdvyvngdhavtiggtqfifgplssawtpfdnkivvy
kdevfnqdfppygsgqpgrfgdiqsrtvesndlyantalklarpspgmvhvpytqtpsgf
kywlkekgtalntkapfgcqiktnpvramncavgnipvsmnlpdsaftrive

SCOP Domain Coordinates for d1rerc2:

Click to download the PDB-style file with coordinates for d1rerc2.
(The format of our PDB-style files is described here.)

Timeline for d1rerc2: