| Class b: All beta proteins [48724] (178 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (24 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
| Family b.1.18.4: Class II viral fusion proteins C-terminal domain [81284] (3 proteins) |
| Protein Fusion glycoprotein E1 [74840] (1 species) |
| Species Semliki forest virus [TaxId:11033] [74841] (3 PDB entries) |
| Domain d1rerc1: 1rer C:293-391 [97331] Other proteins in same PDB: d1rera2, d1rerb2, d1rerc2 complexed with br, ho, po4 |
PDB Entry: 1rer (more details), 3.2 Å
SCOPe Domain Sequences for d1rerc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rerc1 b.1.18.4 (C:293-391) Fusion glycoprotein E1 {Semliki forest virus [TaxId: 11033]}
aptiidltctvatcthssdfggvltltyktnkngdcsvhshsnvatlqeatakvktagkv
tlhfstasaspsfvvslcsaratcsasceppkdhivpya
Timeline for d1rerc1:
View in 3DDomains from other chains: (mouse over for more information) d1rera1, d1rera2, d1rerb1, d1rerb2 |