Lineage for d1rerb1 (1rer B:293-391)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2375023Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2375406Family b.1.18.4: Class II viral fusion proteins C-terminal domain [81284] (3 proteins)
  6. 2375442Protein Fusion glycoprotein E1 [74840] (1 species)
  7. 2375443Species Semliki forest virus [TaxId:11033] [74841] (3 PDB entries)
  8. 2375447Domain d1rerb1: 1rer B:293-391 [97329]
    Other proteins in same PDB: d1rera2, d1rerb2, d1rerc2
    complexed with br, ho, po4

Details for d1rerb1

PDB Entry: 1rer (more details), 3.2 Å

PDB Description: crystal structure of the homotrimer of fusion glycoprotein e1 from semliki forest virus.
PDB Compounds: (B:) Structural polyprotein

SCOPe Domain Sequences for d1rerb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rerb1 b.1.18.4 (B:293-391) Fusion glycoprotein E1 {Semliki forest virus [TaxId: 11033]}
aptiidltctvatcthssdfggvltltyktnkngdcsvhshsnvatlqeatakvktagkv
tlhfstasaspsfvvslcsaratcsasceppkdhivpya

SCOPe Domain Coordinates for d1rerb1:

Click to download the PDB-style file with coordinates for d1rerb1.
(The format of our PDB-style files is described here.)

Timeline for d1rerb1: