Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (24 families) "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
Family b.1.18.4: Class II viral fusion proteins C-terminal domain [81284] (3 proteins) |
Protein Fusion glycoprotein E1 [74840] (1 species) |
Species Semliki forest virus [TaxId:11033] [74841] (3 PDB entries) |
Domain d1rerb1: 1rer B:293-391 [97329] Other proteins in same PDB: d1rera2, d1rerb2, d1rerc2 complexed with br, ho, po4 |
PDB Entry: 1rer (more details), 3.2 Å
SCOPe Domain Sequences for d1rerb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rerb1 b.1.18.4 (B:293-391) Fusion glycoprotein E1 {Semliki forest virus [TaxId: 11033]} aptiidltctvatcthssdfggvltltyktnkngdcsvhshsnvatlqeatakvktagkv tlhfstasaspsfvvslcsaratcsasceppkdhivpya
Timeline for d1rerb1:
View in 3D Domains from other chains: (mouse over for more information) d1rera1, d1rera2, d1rerc1, d1rerc2 |