Class d: Alpha and beta proteins (a+b) [53931] (286 folds) |
Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily) alpha+beta sandwich |
Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (6 families) N-terminal domain is beta/beta/alpha common fold |
Family d.16.1.5: L-aminoacid/polyamine oxidase [54394] (5 proteins) |
Protein L-aminoacid oxidase [54397] (2 species) |
Species Halys viper (Agkistrodon halys pallas) [TaxId:8714] [102800] (4 PDB entries) |
Domain d1reoa2: 1reo A:320-432 [97326] Other proteins in same PDB: d1reoa1 complexed with cit, fad, nag |
PDB Entry: 1reo (more details), 2.31 Å
SCOP Domain Sequences for d1reoa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1reoa2 d.16.1.5 (A:320-432) L-aminoacid oxidase {Halys viper (Agkistrodon halys pallas)} hyrsgtkifltctkkfwedegihggksttdlpsrfiyypnhnftsgvgviiaygigddan ffqaldfkdcadivindlslihqlpreeiqtfcypsmiqkwsldkyamggitt
Timeline for d1reoa2: