Lineage for d1reoa2 (1reo A:320-432)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 500350Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily)
    alpha+beta sandwich
  4. 500351Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (6 families) (S)
    N-terminal domain is beta/beta/alpha common fold
  5. 500497Family d.16.1.5: L-aminoacid/polyamine oxidase [54394] (5 proteins)
  6. 500498Protein L-aminoacid oxidase [54397] (2 species)
  7. 500499Species Halys viper (Agkistrodon halys pallas) [TaxId:8714] [102800] (4 PDB entries)
  8. 500500Domain d1reoa2: 1reo A:320-432 [97326]
    Other proteins in same PDB: d1reoa1

Details for d1reoa2

PDB Entry: 1reo (more details), 2.31 Å

PDB Description: l-amino acid oxidase from agkistrodon halys pallas

SCOP Domain Sequences for d1reoa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1reoa2 d.16.1.5 (A:320-432) L-aminoacid oxidase {Halys viper (Agkistrodon halys pallas)}
hyrsgtkifltctkkfwedegihggksttdlpsrfiyypnhnftsgvgviiaygigddan
ffqaldfkdcadivindlslihqlpreeiqtfcypsmiqkwsldkyamggitt

SCOP Domain Coordinates for d1reoa2:

Click to download the PDB-style file with coordinates for d1reoa2.
(The format of our PDB-style files is described here.)

Timeline for d1reoa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1reoa1