Lineage for d1reoa1 (1reo A:3-319,A:433-486)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2849308Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. 2849309Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families) (S)
  5. 2849379Family c.3.1.2: FAD-linked reductases, N-terminal domain [51913] (18 proteins)
    C-terminal domain is alpha+beta is common for the family
  6. 2849441Protein L-aminoacid oxidase [51929] (2 species)
  7. 2849442Species Halys viper (Agkistrodon halys) [TaxId:8714] [102179] (4 PDB entries)
    Uniprot Q90W54 21-504
  8. 2849443Domain d1reoa1: 1reo A:3-319,A:433-486 [97325]
    Other proteins in same PDB: d1reoa2
    complexed with cit, fad, nag

Details for d1reoa1

PDB Entry: 1reo (more details), 2.31 Å

PDB Description: l-amino acid oxidase from agkistrodon halys pallas
PDB Compounds: (A:) ahplaao

SCOPe Domain Sequences for d1reoa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1reoa1 c.3.1.2 (A:3-319,A:433-486) L-aminoacid oxidase {Halys viper (Agkistrodon halys) [TaxId: 8714]}
drnpleecfretdyeefleiarnglkatsnpkhvvvvgagmsglsaayvlsgaghqvtvl
easeraggrvrtyrndkedwyanlgpmrlpekhrivreyirkfglqlnefsqendnawyf
iknirkrvgevkkdpgvlkypvkpseegksagqlyeeslgkvveelkrtncsyilnkydt
ystkeyllkegnlspgavdmigdlmnedsgyyvsfpeslrhddifayekrfdeivggmdk
lptsmyraieekvhlnaqvikiqknaekvtvvyqtpakemasvtadyvivcttsratrri
kfepplppkkahalrsvXftpyqfqhfsesltasvdriyfagehtaeahgwidstiksgl
raardvnraseq

SCOPe Domain Coordinates for d1reoa1:

Click to download the PDB-style file with coordinates for d1reoa1.
(The format of our PDB-style files is described here.)

Timeline for d1reoa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1reoa2