Lineage for d1re6b_ (1re6 B:)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 859008Fold d.39: DLC [54647] (1 superfamily)
    core: beta-alpha(2)-beta-X-beta(2); 2 layers: alpha/beta; antiparallel beta-sheet: order 1342
  4. 859009Superfamily d.39.1: DLC [54648] (1 family) (S)
  5. 859010Family d.39.1.1: DLC [54649] (2 proteins)
    8 kDa dynein light chain, DLC8
  6. 859032Protein Dynein light chain 2 (DLC2) [102919] (1 species)
  7. 859033Species Mouse (Mus musculus) [TaxId:10090] [102920] (1 PDB entry)
  8. 859035Domain d1re6b_: 1re6 B: [97321]

Details for d1re6b_

PDB Entry: 1re6 (more details)

PDB Description: localisation of dynein light chains 1 and 2 and their pro-apoptotic ligands
PDB Compounds: (B:) dynein light chain 2

SCOP Domain Sequences for d1re6b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1re6b_ d.39.1.1 (B:) Dynein light chain 2 (DLC2) {Mouse (Mus musculus) [TaxId: 10090]}
gplgsmsdrkaviknadmsedmqqdavdcatqamekyniekdiaayikkefdkkynptwh
civgrnfgsyvthetkhfiyfylgqvaillfksg

SCOP Domain Coordinates for d1re6b_:

Click to download the PDB-style file with coordinates for d1re6b_.
(The format of our PDB-style files is described here.)

Timeline for d1re6b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1re6a_