Lineage for d1re6a1 (1re6 A:1-89)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2551753Fold d.39: DLC [54647] (1 superfamily)
    core: beta-alpha(2)-beta-X-beta(2); 2 layers: alpha/beta; antiparallel beta-sheet: order 1342
  4. 2551754Superfamily d.39.1: DLC [54648] (1 family) (S)
    automatically mapped to Pfam PF01221
  5. 2551755Family d.39.1.1: DLC [54649] (3 proteins)
    8 kDa dynein light chain, DLC8
  6. 2551800Protein Dynein light chain 2 (DLC2) [102919] (1 species)
  7. 2551801Species Mouse (Mus musculus) [TaxId:10090] [102920] (1 PDB entry)
  8. 2551802Domain d1re6a1: 1re6 A:1-89 [97320]
    Other proteins in same PDB: d1re6a2, d1re6b2

Details for d1re6a1

PDB Entry: 1re6 (more details)

PDB Description: localisation of dynein light chains 1 and 2 and their pro-apoptotic ligands
PDB Compounds: (A:) dynein light chain 2

SCOPe Domain Sequences for d1re6a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1re6a1 d.39.1.1 (A:1-89) Dynein light chain 2 (DLC2) {Mouse (Mus musculus) [TaxId: 10090]}
msdrkaviknadmsedmqqdavdcatqamekyniekdiaayikkefdkkynptwhcivgr
nfgsyvthetkhfiyfylgqvaillfksg

SCOPe Domain Coordinates for d1re6a1:

Click to download the PDB-style file with coordinates for d1re6a1.
(The format of our PDB-style files is described here.)

Timeline for d1re6a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1re6a2