Lineage for d1re6a_ (1re6 A:)
- Root: SCOPe 2.05
Class d: Alpha and beta proteins (a+b) [53931] (381 folds) 
Fold d.39: DLC [54647] (1 superfamily)
core: beta-alpha(2)-beta-X-beta(2); 2 layers: alpha/beta; antiparallel beta-sheet: order 1342Superfamily d.39.1: DLC [54648] (1 family) 
automatically mapped to Pfam PF01221Family d.39.1.1: DLC [54649] (3 proteins)
8 kDa dynein light chain, DLC8
Protein Dynein light chain 2 (DLC2) [102919] (1 species) Species Mouse (Mus musculus) [TaxId:10090] [102920] (1 PDB entry) 
Domain d1re6a_: 1re6 A: [97320]
Details for d1re6a_
PDB Entry: 1re6 (more details)
PDB Description: localisation of dynein light chains 1 and 2 and their pro-apoptotic ligands
PDB Compounds: (A:) dynein light chain 2SCOPe Domain Sequences for d1re6a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1re6a_ d.39.1.1 (A:) Dynein light chain 2 (DLC2) {Mouse (Mus musculus) [TaxId: 10090]}
gplgsmsdrkaviknadmsedmqqdavdcatqamekyniekdiaayikkefdkkynptwh
civgrnfgsyvthetkhfiyfylgqvaillfksg
SCOPe Domain Coordinates for d1re6a_:
Click to download the PDB-style file with coordinates for d1re6a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1re6a_:
- d1re6a_ first appeared in SCOP 1.67
- d1re6a_ appears in SCOPe 2.04
- d1re6a_ is called d1re6a1 in SCOPe 2.06
- d1re6a_ appears in the current release, SCOPe 2.08, called d1re6a1
View in 3D
