Lineage for d1re0b_ (1re0 B:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1745105Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 1745754Superfamily a.118.3: Sec7 domain [48425] (2 families) (S)
  5. 1745755Family a.118.3.1: Sec7 domain [48426] (6 proteins)
    Pfam PF01369
  6. 1745756Protein ARF guanine-exchange factor 1 [101413] (1 species)
  7. 1745757Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [101414] (1 PDB entry)
  8. 1745758Domain d1re0b_: 1re0 B: [97318]
    Other proteins in same PDB: d1re0a_
    complexed with ARF1
    complexed with afb, cit, gdp, mg

Details for d1re0b_

PDB Entry: 1re0 (more details), 2.4 Å

PDB Description: Structure of ARF1-GDP bound to Sec7 domain complexed with Brefeldin A
PDB Compounds: (B:) ARF guanine-nucleotide exchange factor 1

SCOPe Domain Sequences for d1re0b_:

Sequence, based on SEQRES records: (download)

>d1re0b_ a.118.3.1 (B:) ARF guanine-exchange factor 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
gshmasdrktefilcvetfnekakkgiqmliekgfidsdsnrdiasflflnngrlnkkti
glllcdpkktsllkefidlfdfkglrvdeairilltkfrlpgesqqieriveafsskysa
dqsndkveledkkagkngsesmteddiihvqpdadsvfvlsysiimlntdshnpqvkdhm
tfddysnnlrgcyngkdfprwylhkiytsikvkeivmpeeh

Sequence, based on observed residues (ATOM records): (download)

>d1re0b_ a.118.3.1 (B:) ARF guanine-exchange factor 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
gshmasdrktefilcvetfnekakkgiqmliekgfidsdsnrdiasflflnngrlnkkti
glllcdpkktsllkefidlfdfkglrvdeairilltkfrlpgesqqieriveafsskysa
dqsvqpdadsvfvlsysiimlntdshnpqvkdhmtfddysnnlrgcyngkdfprwylhki
ytsikvkeivmpeeh

SCOPe Domain Coordinates for d1re0b_:

Click to download the PDB-style file with coordinates for d1re0b_.
(The format of our PDB-style files is described here.)

Timeline for d1re0b_: