Class h: Coiled coil proteins [57942] (6 folds) |
Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies) core: trimeric coiled coil |
Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (1 family) |
Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (1 protein) |
Protein Influenza hemagglutinin (stalk) [58066] (2 species) trimer |
Species Influenza A virus, different strains [TaxId:11320] [58067] (35 PDB entries) |
Domain d1rd8b_: 1rd8 B: [97309] Other proteins in same PDB: d1rd8a_, d1rd8c_, d1rd8e_ |
PDB Entry: 1rd8 (more details), 3 Å
SCOP Domain Sequences for d1rd8b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rd8b_ h.3.1.1 (B:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains} glfgaiagfieggwtgmidgwygyhhqneqgsgyaadqkstqnaidgitnkvnsviekmn tqftavgkefnnlerrienlnkkvddgfldiwtynaellvllenertldfhdsnvrnlye kvksqlknnakeigngcfefyhkcddacmesvrngtydypkyseesklnreeidg
Timeline for d1rd8b_: