Lineage for d1rcwb_ (1rcw B:)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 448927Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
    multihelical; bundle
  4. 448928Superfamily a.132.1: Heme oxygenase-like [48613] (4 families) (S)
    duplication: contains two structural repeats of 3-helical motif
  5. 449020Family a.132.1.4: PqqC-like [101463] (2 proteins)
    Pfam 05312
  6. 449027Protein Hypothetical protein CT610 [101466] (1 species)
    contains a di-iron centre similar to that of the ferritin-like superfamily
  7. 449028Species Chlamydia trachomatis [101467] (1 PDB entry)
  8. 449030Domain d1rcwb_: 1rcw B: [97300]

Details for d1rcwb_

PDB Entry: 1rcw (more details), 2.5 Å

PDB Description: Crystal structure of CT610 from Chlamydia trachomatis

SCOP Domain Sequences for d1rcwb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rcwb_ a.132.1.4 (B:) Hypothetical protein CT610 {Chlamydia trachomatis}
nfldqldliiqnkhmlehtfyvkwskgeltkeqlqayakdyylhikafpkylsaihsrcd
dlearkllldnlmdeengypnhidlwkqfvfalgvtpeeleahepseaakakvatfmrwc
tgdslaagvaalysyesqipriarekirglteyfgfsnpedyayfteheeadvrhareek
aliemllkddadkvleasqevtqslygfldsfld

SCOP Domain Coordinates for d1rcwb_:

Click to download the PDB-style file with coordinates for d1rcwb_.
(The format of our PDB-style files is described here.)

Timeline for d1rcwb_: