Lineage for d1rcwa_ (1rcw A:)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 648983Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
    multihelical; bundle
  4. 648984Superfamily a.132.1: Heme oxygenase-like [48613] (4 families) (S)
    duplication: contains two structural repeats of 3-helical motif
  5. 649159Family a.132.1.4: PqqC-like [101463] (2 proteins)
    Pfam PF05312
  6. 649166Protein Hypothetical protein CT610 [101466] (1 species)
    contains a di-iron centre similar to that of the ferritin-like superfamily
  7. 649167Species Chlamydia trachomatis [TaxId:813] [101467] (1 PDB entry)
  8. 649168Domain d1rcwa_: 1rcw A: [97299]

Details for d1rcwa_

PDB Entry: 1rcw (more details), 2.5 Å

PDB Description: Crystal structure of CT610 from Chlamydia trachomatis
PDB Compounds: (A:) ct610

SCOP Domain Sequences for d1rcwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rcwa_ a.132.1.4 (A:) Hypothetical protein CT610 {Chlamydia trachomatis [TaxId: 813]}
nfldqldliiqnkhmlehtfyvkwskgeltkeqlqayakdyylhikafpkylsaihsrcd
dlearkllldnlmdeengypnhidlwkqfvfalgvtpeeleahepseaakakvatfmrwc
tgdslaagvaalysyesqipriarekirglteyfgfsnpedyayfteheeadvrhareek
aliemllkddadkvleasqevtqslygfldsfl

SCOP Domain Coordinates for d1rcwa_:

Click to download the PDB-style file with coordinates for d1rcwa_.
(The format of our PDB-style files is described here.)

Timeline for d1rcwa_: