SCOP 1.71: Domain d1rcwa_: 1rcw A:

Lineage for d1rcwa_ (1rcw A:)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
   multihelical; bundle

4. Superfamily a.132.1: Heme oxygenase-like [48613] (4 families)
   duplication: contains two structural repeats of 3-helical motif

5. Family a.132.1.4: PqqC-like [101463] (2 proteins)
   Pfam 05312

6. Protein Hypothetical protein CT610 [101466] (1 species)
   contains a di-iron centre similar to that of the ferritin-like superfamily

7. Species Chlamydia trachomatis [101467] (1 PDB entry)

8. Domain d1rcwa_: 1rcw A: [97299]

Details for d1rcwa_

PDB Entry: 1rcw, 2.5 Å

PDB Description: Crystal structure of CT610 from Chlamydia trachomatis

SCOP Domain Sequences for d1rcwa_:

Sequence; same for both SEQRES and ATOM records:

>d1rcwa_ a.132.1.4 (A:) Hypothetical protein CT610 {Chlamydia trachomatis}
nfldqldliiqnkhmlehtfyvkwskgeltkeqlqayakdyylhikafpkylsaihsrcd
dlearkllldnlmdeengypnhidlwkqfvfalgvtpeeleahepseaakakvatfmrwc
tgdslaagvaalysyesqipriarekirglteyfgfsnpedyayfteheeadvrhareek
aliemllkddadkvleasqevtqslygfldsfl

Timeline for d1rcwa_:

• d1rcwa_ first appeared in SCOP 1.67
  
• d1rcwa_ appears in SCOP 1.69
  
• d1rcwa_ appears in SCOP 1.73
  
• d1rcwa_ appears in the current release, SCOPe 2.08