Lineage for d1rcud_ (1rcu D:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2169999Fold c.129: MCP/YpsA-like [102404] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 7 strands, order 4321567
  4. 2170000Superfamily c.129.1: MCP/YpsA-like [102405] (3 families) (S)
  5. 2170001Family c.129.1.1: MoCo carrier protein-like [102406] (6 proteins)
    Pfam PF03641
  6. 2170014Protein Hypothetical protein TM1055 [102407] (1 species)
  7. 2170015Species Thermotoga maritima [TaxId:2336] [102408] (1 PDB entry)
    structural genomics; NESG target VT76
  8. 2170019Domain d1rcud_: 1rcu D: [97298]

Details for d1rcud_

PDB Entry: 1rcu (more details), 2.5 Å

PDB Description: x-ray structure of tm1055 northeast structural genomics consortium target vt76
PDB Compounds: (D:) conserved hypothetical protein VT76

SCOPe Domain Sequences for d1rcud_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rcud_ c.129.1.1 (D:) Hypothetical protein TM1055 {Thermotoga maritima [TaxId: 2336]}
mkkvvvvgysgpvnkspvselrdiclelgrtlakkgylvfnggrdgvmelvsqgvreagg
tvvgilpdeeagnpylsvavktgldfqmrsfvllrnadvvvsiggeigtaieilgayalg
kpvillrgtggwtdrisqvlidgkyldnrriveihqawtveeavqiieqi

SCOPe Domain Coordinates for d1rcud_:

Click to download the PDB-style file with coordinates for d1rcud_.
(The format of our PDB-style files is described here.)

Timeline for d1rcud_: