Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.129: MCP/YpsA-like [102404] (1 superfamily) 3 layers: a/b/a, parallel beta-sheet of 7 strands, order 4321567 |
Superfamily c.129.1: MCP/YpsA-like [102405] (3 families) |
Family c.129.1.1: MoCo carrier protein-like [102406] (6 proteins) Pfam PF03641 |
Protein Hypothetical protein TM1055 [102407] (1 species) |
Species Thermotoga maritima [TaxId:2336] [102408] (1 PDB entry) structural genomics; NESG target VT76 |
Domain d1rcud_: 1rcu D: [97298] |
PDB Entry: 1rcu (more details), 2.5 Å
SCOPe Domain Sequences for d1rcud_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rcud_ c.129.1.1 (D:) Hypothetical protein TM1055 {Thermotoga maritima [TaxId: 2336]} mkkvvvvgysgpvnkspvselrdiclelgrtlakkgylvfnggrdgvmelvsqgvreagg tvvgilpdeeagnpylsvavktgldfqmrsfvllrnadvvvsiggeigtaieilgayalg kpvillrgtggwtdrisqvlidgkyldnrriveihqawtveeavqiieqi
Timeline for d1rcud_: