Lineage for d1rc8a1 (1rc8 A:153-301)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 404418Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 404419Superfamily c.108.1: HAD-like [56784] (14 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 404522Family c.108.1.9: Polynucleotide kinase, phosphatase domain [82385] (1 protein)
    no insertion subdomains
  6. 404523Protein Polynucleotide kinase, phosphatase domain [82386] (1 species)
  7. 404524Species Bacteriophage T4 [TaxId:10665] [82387] (4 PDB entries)
  8. 404527Domain d1rc8a1: 1rc8 A:153-301 [97291]
    Other proteins in same PDB: d1rc8a2
    complexed with adp, ca, dms

Details for d1rc8a1

PDB Entry: 1rc8 (more details), 2.75 Å

PDB Description: T4 Polynucleotide Kinase bound to 5'-GTCAC-3' ssDNA

SCOP Domain Sequences for d1rc8a1:

Sequence, based on SEQRES records: (download)

>d1rc8a1 c.108.1.9 (A:153-301) Polynucleotide kinase, phosphatase domain {Bacteriophage T4}
ngtpgkpkavifdvdgtlakmngrgpydlekcdtdvinpmvvelskmyalmgyqivvvsg
resgtkedptkyyrmtrkwvediagvplvmqcqreqgdtrkddvvkeeifwkhiaphfdv
klaiddrtqvvemwrrigvecwqvasgdf

Sequence, based on observed residues (ATOM records): (download)

>d1rc8a1 c.108.1.9 (A:153-301) Polynucleotide kinase, phosphatase domain {Bacteriophage T4}
ngtpgkpkavifdvdgtlakmtdvinpmvvelskmyalmgyqivvvsgresgtkedptky
yrmtrkwvediagvplvmqcqreqgdtrkddvvkeeifwkhiaphfdvklaiddrtqvve
mwrrigvecwqvasgdf

SCOP Domain Coordinates for d1rc8a1:

Click to download the PDB-style file with coordinates for d1rc8a1.
(The format of our PDB-style files is described here.)

Timeline for d1rc8a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1rc8a2