SCOP 1.69: Domain d1rc7a1: 1rc7 A:1-150

Lineage for d1rc7a1 (1rc7 A:1-150)

1. Root: SCOP 1.69

2. Class a: All alpha proteins [46456] (218 folds)

3. Fold a.149: RNase III catalytic domain-like (Pfam 00636) [69064] (1 superfamily)
   core: 5 helices; one helix is surrounded by the others

4. Superfamily a.149.1: RNase III catalytic domain-like (Pfam 00636) [69065] (1 family)

5. Family a.149.1.1: RNase III catalytic domain-like (Pfam 00636) [69066] (2 proteins)

6. Protein RNase III endonuclease catalytic domain [69067] (2 species)

7. Species Aquifex aeolicus [TaxId:63363] [69068] (4 PDB entries)

8. Domain d1rc7a1: 1rc7 A:1-150 [97289]
   Other proteins in same PDB: d1rc7a2

Details for d1rc7a1

PDB Entry: 1rc7, 2.15 Å

PDB Description: crystal structure of rnase iii mutant e110k from aquifex aeolicus complexed with ds-rna at 2.15 angstrom resolution

SCOP Domain Sequences for d1rc7a1:

Sequence; same for both SEQRES and ATOM records:

>d1rc7a1 a.149.1.1 (A:1-150) RNase III endonuclease catalytic domain {Aquifex aeolicus}
mkmleqlekklgytfkdksllekalthvsyskkehyetleflgdalvnffivdllvqysp
nkregflsplkayliseeffnllaqklelhkfirikrgkinetiigdvfkalwaavyids
grdanftrelfyklfkedilsaikegrvkk

Timeline for d1rc7a1:

• d1rc7a1 first appeared in SCOP 1.67
  
• d1rc7a1 appears in SCOP 1.71
  
• d1rc7a1 appears in the current release, SCOPe 2.08