Lineage for d1rc6b_ (1rc6 B:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2070014Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2070015Superfamily b.82.1: RmlC-like cupins [51182] (25 families) (S)
  5. 2070385Family b.82.1.11: YlbA-like [101979] (4 protein domains)
    Pfam PF05899; formerly pfam06038; duplication: consists of two germin-like domains
  6. 2070397Protein Hypothetical protein YlbA [101980] (1 species)
  7. 2070398Species Escherichia coli [TaxId:562] [101981] (1 PDB entry)
  8. 2070400Domain d1rc6b_: 1rc6 B: [97288]
    structural genomics

Details for d1rc6b_

PDB Entry: 1rc6 (more details), 2.6 Å

PDB Description: Crystal structure of protein Ylba from E. coli, Pfam DUF861
PDB Compounds: (B:) Hypothetical protein ylbA

SCOPe Domain Sequences for d1rc6b_:

Sequence, based on SEQRES records: (download)

>d1rc6b_ b.82.1.11 (B:) Hypothetical protein YlbA {Escherichia coli [TaxId: 562]}
gyredllanraivkhgnfalltpdglvkniipgfencdatilstpklgasfvdylvtlhq
nggnqqgfggegietflyvisgnitakaegktfalseggylycppgslmtfvnaqaedsq
iflykrryvpvegyapwlvsgnaselerihyegmddvilldflpkelgfdmnmhilsfap
gashgyiethvqehgayilsgqgvynldnnwipvkkgdyifmgayslqagygvgrgeafs
yiyskdcnrdvei

Sequence, based on observed residues (ATOM records): (download)

>d1rc6b_ b.82.1.11 (B:) Hypothetical protein YlbA {Escherichia coli [TaxId: 562]}
gyredllanraivkhgnfalltpdglvkniipgfencdatilstpklgasfvdylvtlhq
nggnqqgfggegietflyvisgnitakaegktfalseggylycppgslmtfvnaqaedsq
iflykrryvpvegyapwlvsgnaselerivilldflpkelgfdmnmhilsfapgashgyi
ethvqehgayilsgqgvynldnnwipvkkgdyifmgayslqagygvafsyiyskdcnrdv
ei

SCOPe Domain Coordinates for d1rc6b_:

Click to download the PDB-style file with coordinates for d1rc6b_.
(The format of our PDB-style files is described here.)

Timeline for d1rc6b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1rc6a_