Class b: All beta proteins [48724] (180 folds) |
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.1: RmlC-like cupins [51182] (25 families) |
Family b.82.1.11: YlbA-like [101979] (4 proteins) Pfam PF05899; formerly pfam06038; duplication: consists of two germin-like domains |
Protein Hypothetical protein YlbA [101980] (1 species) |
Species Escherichia coli [TaxId:562] [101981] (1 PDB entry) |
Domain d1rc6a_: 1rc6 A: [97287] structural genomics |
PDB Entry: 1rc6 (more details), 2.6 Å
SCOPe Domain Sequences for d1rc6a_:
Sequence, based on SEQRES records: (download)
>d1rc6a_ b.82.1.11 (A:) Hypothetical protein YlbA {Escherichia coli [TaxId: 562]} gyredllanraivkhgnfalltpdglvkniipgfencdatilstpklgasfvdylvtlhq nggnqqgfggegietflyvisgnitakaegktfalseggylycppgslmtfvnaqaedsq iflykrryvpvegyapwlvsgnaselerihyegmddvilldflpkelgfdmnmhilsfap gashgyiethvqehgayilsgqgvynldnnwipvkkgdyifmgayslqagygvgrgeafs yiyskdcnrdvei
>d1rc6a_ b.82.1.11 (A:) Hypothetical protein YlbA {Escherichia coli [TaxId: 562]} gyredllanraivkhgnfalltpdglvkniipgfencdatilstpklgasfvdylvtlhq nggnqqgfggegietflyvisgnitakaegktfalseggylycppgslmtfvnaqaedsq iflykrryvpvegyapwlvsgnaselerivilldflpkelgfdmnmhilsfapgashgyi ethvqehgayilsgqgvynldnnwipvkkgdyifmgayslqagygvafsyiyskdcnrdv ei
Timeline for d1rc6a_: