SCOP 1.67: Domain d1rc5c_: 1rc5 C:

Lineage for d1rc5c_ (1rc5 C:)

1. Root: SCOP 1.67

2. Class a: All alpha proteins [46456] (202 folds)

3. Fold a.149: RNase III endonuclease catalytic domain [69064] (1 superfamily)
   core: 5 helices; one helix is surrounded by the others

4. Superfamily a.149.1: RNase III endonuclease catalytic domain [69065] (1 family)

5. Family a.149.1.1: RNase III endonuclease catalytic domain [69066] (1 protein)

6. Protein RNase III endonuclease catalytic domain [69067] (2 species)

7. Species Aquifex aeolicus [TaxId:63363] [69068] (4 PDB entries)

8. Domain d1rc5c_: 1rc5 C: [97285]

Details for d1rc5c_

PDB Entry: 1rc5, 2.3 Å

PDB Description: crystal structure of mg(ii)-complex of rnase iii endonuclease domain from aquifex aeolicus at 2.30 angstrom resolution

SCOP Domain Sequences for d1rc5c_:

Sequence; same for both SEQRES and ATOM records:

>d1rc5c_ a.149.1.1 (C:) RNase III endonuclease catalytic domain {Aquifex aeolicus}
gmkmleqlekklgytfkdksllekalthvsyskkehyetleflgdalvnffivdllvqys
pnkregflsplkayliseeffnllaqklelhkfirikrgkinetiigdvfealwaavyid
sgrdanftrelfyklfkedilsaikegrh

Timeline for d1rc5c_:

• d1rc5c_ is new in SCOP 1.67
  
• d1rc5c_ appears in SCOP 1.69
  
• d1rc5c_ appears in the current release, SCOPe 2.08, called d1rc5c1