Class a: All alpha proteins [46456] (289 folds) |
Fold a.149: RNase III domain-like [69064] (1 superfamily) core: 5 helices; one helix is surrounded by the others |
Superfamily a.149.1: RNase III domain-like [69065] (3 families) |
Family a.149.1.1: RNase III catalytic domain-like [69066] (2 proteins) Pfam PF00636 |
Protein RNase III endonuclease catalytic domain [69067] (2 species) |
Species Aquifex aeolicus [TaxId:63363] [69068] (12 PDB entries) |
Domain d1rc5b1: 1rc5 B:200-347 [97284] Other proteins in same PDB: d1rc5b2, d1rc5c2 protein/RNA complex; complexed with mg |
PDB Entry: 1rc5 (more details), 2.3 Å
SCOPe Domain Sequences for d1rc5b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rc5b1 a.149.1.1 (B:200-347) RNase III endonuclease catalytic domain {Aquifex aeolicus [TaxId: 63363]} gmkmleqlekklgytfkdksllekalthvsyskkehyetleflgdalvnffivdllvqys pnkregflsplkayliseeffnllaqklelhkfirikrgkinetiigdvfealwaavyid sgrdanftrelfyklfkedilsaikegr
Timeline for d1rc5b1:
View in 3D Domains from other chains: (mouse over for more information) d1rc5a_, d1rc5c1, d1rc5c2, d1rc5d_ |