SCOP 1.75: Domain d1rc5a_: 1rc5 A:

Lineage for d1rc5a_ (1rc5 A:)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.149: RNase III domain-like [69064] (1 superfamily)
   core: 5 helices; one helix is surrounded by the others

4. Superfamily a.149.1: RNase III domain-like [69065] (2 families)

5. Family a.149.1.1: RNase III catalytic domain-like [69066] (2 proteins)
   Pfam PF00636

6. Protein RNase III endonuclease catalytic domain [69067] (2 species)

7. Species Aquifex aeolicus [TaxId:63363] [69068] (12 PDB entries)

8. Domain d1rc5a_: 1rc5 A: [97283]

Details for d1rc5a_

PDB Entry: 1rc5, 2.3 Å

PDB Description: crystal structure of mg(ii)-complex of rnase iii endonuclease domain from aquifex aeolicus at 2.30 angstrom resolution

PDB Compounds: (A:) Ribonuclease III

SCOP Domain Sequences for d1rc5a_:

Sequence; same for both SEQRES and ATOM records:

>d1rc5a_ a.149.1.1 (A:) RNase III endonuclease catalytic domain {Aquifex aeolicus [TaxId: 63363]}
gmkmleqlekklgytfkdksllekalthvsyskkehyetleflgdalvnffivdllvqys
pnkregflsplkayliseeffnllaqklelhkfirikrgkinetiigdvfealwaavyid
sgrdanftrelfyklfkedilsaikegr

Timeline for d1rc5a_:

• d1rc5a_ first appeared in SCOP 1.67
  
• d1rc5a_ appears in SCOP 1.73
  
• d1rc5a_ appears in SCOPe 2.01
  
• d1rc5a_ appears in the current release, SCOPe 2.08