Lineage for d1rc5a_ (1rc5 A:)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 361926Fold a.149: RNase III endonuclease catalytic domain [69064] (1 superfamily)
    core: 5 helices; one helix is surrounded by the others
  4. 361927Superfamily a.149.1: RNase III endonuclease catalytic domain [69065] (1 family) (S)
  5. 361928Family a.149.1.1: RNase III endonuclease catalytic domain [69066] (1 protein)
  6. 361929Protein RNase III endonuclease catalytic domain [69067] (2 species)
  7. 361930Species Aquifex aeolicus [TaxId:63363] [69068] (4 PDB entries)
  8. 361938Domain d1rc5a_: 1rc5 A: [97283]

Details for d1rc5a_

PDB Entry: 1rc5 (more details), 2.3 Å

PDB Description: crystal structure of mg(ii)-complex of rnase iii endonuclease domain from aquifex aeolicus at 2.30 angstrom resolution

SCOP Domain Sequences for d1rc5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rc5a_ a.149.1.1 (A:) RNase III endonuclease catalytic domain {Aquifex aeolicus}
gmkmleqlekklgytfkdksllekalthvsyskkehyetleflgdalvnffivdllvqys
pnkregflsplkayliseeffnllaqklelhkfirikrgkinetiigdvfealwaavyid
sgrdanftrelfyklfkedilsaikegr

SCOP Domain Coordinates for d1rc5a_:

Click to download the PDB-style file with coordinates for d1rc5a_.
(The format of our PDB-style files is described here.)

Timeline for d1rc5a_: