Lineage for d1rc5a_ (1rc5 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2735030Fold a.149: RNase III domain-like [69064] (1 superfamily)
    core: 5 helices; one helix is surrounded by the others
  4. 2735031Superfamily a.149.1: RNase III domain-like [69065] (3 families) (S)
  5. 2735032Family a.149.1.1: RNase III catalytic domain-like [69066] (2 proteins)
    Pfam PF00636
  6. 2735036Protein RNase III endonuclease catalytic domain [69067] (2 species)
  7. 2735037Species Aquifex aeolicus [TaxId:63363] [69068] (12 PDB entries)
  8. 2735051Domain d1rc5a_: 1rc5 A: [97283]
    Other proteins in same PDB: d1rc5b2, d1rc5c2
    protein/RNA complex; complexed with mg

Details for d1rc5a_

PDB Entry: 1rc5 (more details), 2.3 Å

PDB Description: crystal structure of mg(ii)-complex of rnase iii endonuclease domain from aquifex aeolicus at 2.30 angstrom resolution
PDB Compounds: (A:) Ribonuclease III

SCOPe Domain Sequences for d1rc5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rc5a_ a.149.1.1 (A:) RNase III endonuclease catalytic domain {Aquifex aeolicus [TaxId: 63363]}
gmkmleqlekklgytfkdksllekalthvsyskkehyetleflgdalvnffivdllvqys
pnkregflsplkayliseeffnllaqklelhkfirikrgkinetiigdvfealwaavyid
sgrdanftrelfyklfkedilsaikegr

SCOPe Domain Coordinates for d1rc5a_:

Click to download the PDB-style file with coordinates for d1rc5a_.
(The format of our PDB-style files is described here.)

Timeline for d1rc5a_: