SCOPe 2.06: Domain d1rb8f_: 1rb8 F:

Lineage for d1rb8f_ (1rb8 F:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
   sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
   characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies

4. Superfamily b.121.5: ssDNA viruses [88645] (3 families)

5. Family b.121.5.1: Microviridae-like VP [49612] (1 protein)

6. Protein Microvirus capsid proteins [49613] (3 species)
   include capsid protein F and spike protein G

7. Species Bacteriophage alpha3 [TaxId:10849] [82008] (2 PDB entries)

8. Domain d1rb8f_: 1rb8 F: [97279]
   protein/DNA complex; complexed with dc

Details for d1rb8f_

PDB Entry: 1rb8, 3.5 Å

PDB Description: the phix174 dna binding protein j in two different capsid environments.

PDB Compounds: (F:) capsid protein

SCOPe Domain Sequences for d1rb8f_:

Sequence; same for both SEQRES and ATOM records:

>d1rb8f_ b.121.5.1 (F:) Microvirus capsid proteins {Bacteriophage alpha3 [TaxId: 10849]}
reivdlshlafdcgmlgrlktvswtpviagdsfeldavgalrlsplrrglaidskvdfft
fyiphrhvygdqwiqfmrdgvnaqplpsvtcnrypdhagyvgtivpannripkflhqsyl
niynnyfrapwmperteanpsnlneddarygfrcchlkniwsaplppetklaeemgiesn
sidimglqaayaqlhteqertyfmqryrdvissfggstsydadnrpllvmhtdfwasgyd
vdgtdqsslgqfsgrvqqtfkhsvprffvpehgvmmtlalirfppisplehhylagksql
tytdlagdpalignlppreisyrdlfrdgrsgikikvaesiwyrthpdyvnfkyhdlhgf
pflddapgtstgdnlqeailvrhqdydacfqsqqllqwnkqarynvsvyrhmptvrdsim
ts

Timeline for d1rb8f_:

• d1rb8f_ first appeared in SCOP 1.67
  
• d1rb8f_ appears in SCOPe 2.05
  
• d1rb8f_ appears in SCOPe 2.07
  
• d1rb8f_ appears in the current release, SCOPe 2.08