Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies) core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest |
Superfamily c.97.1: Cytidine deaminase-like [53927] (7 families) contains extra C-terminal strand 5, order 21345 |
Family c.97.1.2: Deoxycytidylate deaminase-like [89800] (8 proteins) strand 5 is parallel to strand 4 |
Protein Cytosine deaminase [89801] (1 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [89802] (7 PDB entries) |
Domain d1rb7a_: 1rb7 A: [97277] complexed with zn |
PDB Entry: 1rb7 (more details), 2.1 Å
SCOPe Domain Sequences for d1rb7a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rb7a_ c.97.1.2 (A:) Cytosine deaminase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} askwdqkgmdiayeeaalgykeggvpiggclinnkdgsvlgrghnmrfqkgsatlhgeis tlencgrlegkvykdttlyttlspcdmctgaiimygiprcvvgenvnfkskgekylqtrg hevvvvdderckkimkqfiderpqdwfedige
Timeline for d1rb7a_: