Lineage for d1rb7a_ (1rb7 A:)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 847589Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies)
    core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest
  4. 847590Superfamily c.97.1: Cytidine deaminase-like [53927] (5 families) (S)
    contains extra C-terminal strand 5, order 21345
  5. 847654Family c.97.1.2: Deoxycytidylate deaminase-like [89800] (7 proteins)
    strand 5 is parallel to strand 4
  6. 847659Protein Cytosine deaminase [89801] (1 species)
  7. 847660Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [89802] (6 PDB entries)
  8. 847671Domain d1rb7a_: 1rb7 A: [97277]

Details for d1rb7a_

PDB Entry: 1rb7 (more details), 2.1 Å

PDB Description: Yeast cytosine deaminase crystal form p212121 with sodium acetate.
PDB Compounds: (A:) Cytosine deaminase

SCOP Domain Sequences for d1rb7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rb7a_ c.97.1.2 (A:) Cytosine deaminase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
askwdqkgmdiayeeaalgykeggvpiggclinnkdgsvlgrghnmrfqkgsatlhgeis
tlencgrlegkvykdttlyttlspcdmctgaiimygiprcvvgenvnfkskgekylqtrg
hevvvvdderckkimkqfiderpqdwfedige

SCOP Domain Coordinates for d1rb7a_:

Click to download the PDB-style file with coordinates for d1rb7a_.
(The format of our PDB-style files is described here.)

Timeline for d1rb7a_: