Lineage for d1rb6c_ (1rb6 C:)

  1. Root: SCOP 1.73
  2. 752207Class h: Coiled coil proteins [57942] (7 folds)
  3. 752208Fold h.1: Parallel coiled-coil [57943] (33 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 752378Superfamily h.1.3: Leucine zipper domain [57959] (1 family) (S)
  5. 752379Family h.1.3.1: Leucine zipper domain [57960] (16 proteins)
  6. 752439Protein GCN4 [57961] (1 species)
  7. 752440Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [57962] (58 PDB entries)
  8. 752555Domain d1rb6c_: 1rb6 C: [97276]
    trimeric mutant

Details for d1rb6c_

PDB Entry: 1rb6 (more details), 1.9 Å

PDB Description: antiparallel trimer of gcn4-leucine zipper core mutant as n16a tetragonal form
PDB Compounds: (C:) General control protein GCN4

SCOP Domain Sequences for d1rb6c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rb6c_ h.1.3.1 (C:) GCN4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
rmkqledkveellskayhlenevarlkklvg

SCOP Domain Coordinates for d1rb6c_:

Click to download the PDB-style file with coordinates for d1rb6c_.
(The format of our PDB-style files is described here.)

Timeline for d1rb6c_: