Class h: Coiled coil proteins [57942] (7 folds) |
Fold h.1: Parallel coiled-coil [57943] (33 superfamilies) this is not a true fold; includes oligomers of shorter identical helices |
Superfamily h.1.3: Leucine zipper domain [57959] (1 family) |
Family h.1.3.1: Leucine zipper domain [57960] (16 proteins) |
Protein GCN4 [57961] (1 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [57962] (58 PDB entries) |
Domain d1rb6c_: 1rb6 C: [97276] trimeric mutant |
PDB Entry: 1rb6 (more details), 1.9 Å
SCOP Domain Sequences for d1rb6c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rb6c_ h.1.3.1 (C:) GCN4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} rmkqledkveellskayhlenevarlkklvg
Timeline for d1rb6c_: