Lineage for d1rb5a_ (1rb5 A:)

  1. Root: SCOP 1.75
  2. 894739Class h: Coiled coil proteins [57942] (7 folds)
  3. 894740Fold h.1: Parallel coiled-coil [57943] (34 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 894928Superfamily h.1.3: Leucine zipper domain [57959] (1 family) (S)
  5. 894929Family h.1.3.1: Leucine zipper domain [57960] (16 proteins)
  6. 894995Protein GCN4 [57961] (2 species)
  7. 894996Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [57962] (62 PDB entries)
    Uniprot P03069 249-279
    Uniprot P03069 249-281
    Uniprot P03069 249-279 ! Uniprot P03069 249-281
  8. 895094Domain d1rb5a_: 1rb5 A: [97271]
    trimeric mutant

Details for d1rb5a_

PDB Entry: 1rb5 (more details), 1.9 Å

PDB Description: antiparallel trimer of gcn4-leucine zipper core mutant as n16a trigonal form
PDB Compounds: (A:) General control protein GCN4

SCOP Domain Sequences for d1rb5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rb5a_ h.1.3.1 (A:) GCN4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
rmkqledkveellskayhlenevarlkklvger

SCOP Domain Coordinates for d1rb5a_:

Click to download the PDB-style file with coordinates for d1rb5a_.
(The format of our PDB-style files is described here.)

Timeline for d1rb5a_: