Lineage for d1rb1b_ (1rb1 B:)

  1. Root: SCOP 1.71
  2. 625746Class h: Coiled coil proteins [57942] (7 folds)
  3. 625747Fold h.1: Parallel coiled-coil [57943] (29 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 625902Superfamily h.1.3: Leucine zipper domain [57959] (1 family) (S)
  5. 625903Family h.1.3.1: Leucine zipper domain [57960] (15 proteins)
  6. 625961Protein GCN4 [57961] (1 species)
  7. 625962Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [57962] (50 PDB entries)
  8. 626089Domain d1rb1b_: 1rb1 B: [97266]

Details for d1rb1b_

PDB Entry: 1rb1 (more details), 1.9 Å

PDB Description: gcn4-leucine zipper core mutant as n16a trigonal automatic solution

SCOP Domain Sequences for d1rb1b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rb1b_ h.1.3.1 (B:) GCN4 {Baker's yeast (Saccharomyces cerevisiae)}
rmkqledkveellskayhlenevarlkklvg

SCOP Domain Coordinates for d1rb1b_:

Click to download the PDB-style file with coordinates for d1rb1b_.
(The format of our PDB-style files is described here.)

Timeline for d1rb1b_: