SCOPe 2.05: Domain d1r9wa_: 1r9w A:

Lineage for d1r9wa_ (1r9w A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.89: Origin of replication-binding domain, RBD-like [55463] (1 superfamily)
   alpha-beta-alpha-beta(2)-alpha-beta-alpha-beta; 3 layers: a/b/a; antiparallel sheet 41325

4. Superfamily d.89.1: Origin of replication-binding domain, RBD-like [55464] (6 families)

5. Family d.89.1.2: Replication initiation protein E1 [64332] (1 protein)
   automatically mapped to Pfam PF00519

6. Protein Replication initiation protein E1 [64333] (2 species)

7. Species Human papillomavirus type 18 [TaxId:333761] [103119] (1 PDB entry)

8. Domain d1r9wa_: 1r9w A: [97264]

Details for d1r9wa_

PDB Entry: 1r9w, 1.8 Å

PDB Description: Crystal Structure of the DNA-binding domain of the human papillomavirus type 18 (HPV-18) replication initiation protein E1

PDB Compounds: (A:) replication protein e1

SCOPe Domain Sequences for d1r9wa_:

Sequence, based on SEQRES records:

>d1r9wa_ d.89.1.2 (A:) Replication initiation protein E1 {Human papillomavirus type 18 [TaxId: 333761]}
kqgamlavfkdtyglsftdlvrnfksdkttctdwvtaifgvnptiaegfktliqpfilya
hiqcldckwgvlilallrykcgksrltvakglstllhvpetcmliqppklrssvaalywy
rtgisnisevmgdtpewiqrltiiq

Sequence, based on observed residues (ATOM records):

>d1r9wa_ d.89.1.2 (A:) Replication initiation protein E1 {Human papillomavirus type 18 [TaxId: 333761]}
kqgamlavfkdtyglsftdlvrtctdwvtaifgvnptiaegfktliqpfilyahiqcldc
kwgvlilallrykcgksrltvakglstllhvpetcmliqppklrssvaalywyrtgisni
sevmgdtpewiqrltiiq

Timeline for d1r9wa_:

• d1r9wa_ first appeared in SCOP 1.67
  
• d1r9wa_ appears in SCOPe 2.04
  
• d1r9wa_ appears in SCOPe 2.06
  
• d1r9wa_ appears in the current release, SCOPe 2.08