Lineage for d1r9wa_ (1r9w A:)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 415324Fold d.89: Origin of replication-binding domain, RBD-like [55463] (1 superfamily)
    alpha-beta-alpha-beta(2)-alpha-beta-alpha-beta; 3 layers: a/b/a; antiparallel sheet 41325
  4. 415325Superfamily d.89.1: Origin of replication-binding domain, RBD-like [55464] (5 families) (S)
  5. 415331Family d.89.1.2: Replication initiation protein E1 [64332] (1 protein)
  6. 415332Protein Replication initiation protein E1 [64333] (2 species)
  7. 415347Species Human papillomavirus type 18 [TaxId:333761] [103119] (1 PDB entry)
  8. 415348Domain d1r9wa_: 1r9w A: [97264]

Details for d1r9wa_

PDB Entry: 1r9w (more details), 1.8 Å

PDB Description: Crystal Structure of the DNA-binding domain of the human papillomavirus type 18 (HPV-18) replication initiation protein E1

SCOP Domain Sequences for d1r9wa_:

Sequence, based on SEQRES records: (download)

>d1r9wa_ d.89.1.2 (A:) Replication initiation protein E1 {Human papillomavirus type 18}
kqgamlavfkdtyglsftdlvrnfksdkttctdwvtaifgvnptiaegfktliqpfilya
hiqcldckwgvlilallrykcgksrltvakglstllhvpetcmliqppklrssvaalywy
rtgisnisevmgdtpewiqrltiiq

Sequence, based on observed residues (ATOM records): (download)

>d1r9wa_ d.89.1.2 (A:) Replication initiation protein E1 {Human papillomavirus type 18}
kqgamlavfkdtyglsftdlvrtctdwvtaifgvnptiaegfktliqpfilyahiqcldc
kwgvlilallrykcgksrltvakglstllhvpetcmliqppklrssvaalywyrtgisni
sevmgdtpewiqrltiiq

SCOP Domain Coordinates for d1r9wa_:

Click to download the PDB-style file with coordinates for d1r9wa_.
(The format of our PDB-style files is described here.)

Timeline for d1r9wa_: