SCOPe 2.05: Domain d1r9qa_: 1r9q A:

Lineage for d1r9qa_ (1r9q A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (43 proteins)

6. Protein Glycine betaine-binding periplasmic protein ProX [102702] (1 species)

7. Species Escherichia coli [TaxId:562] [102703] (2 PDB entries)

8. Domain d1r9qa_: 1r9q A: [97263]
   complexed with pbe, unx

Details for d1r9qa_

PDB Entry: 1r9q, 2.05 Å

PDB Description: structure analysis of prox in complex with proline betaine

PDB Compounds: (A:) Glycine betaine-binding periplasmic protein

SCOPe Domain Sequences for d1r9qa_:

Sequence; same for both SEQRES and ATOM records:

>d1r9qa_ c.94.1.1 (A:) Glycine betaine-binding periplasmic protein ProX {Escherichia coli [TaxId: 562]}
adlpgkgitvnpvqstiteetfqtllvsraleklgytvnkpsevdynvgytslasgdatf
tavnwtplhdnmyeaaggdkkfyregvfvngaaqgylidkktadqykitniaqlkdpkia
klfdtngdgkadltgcnpgwgcegainhqlaayeltntvthnqgnyaammadtisrykeg
kpvfyytwtpywvsnelkpgkdvvwlqvpfsalpgdknadtklpnganygfpvstmhiva
nkawaeknpaaaklfaimqlpvadinaqnaimhdgkasegdiqghvdgwikahqqqfdgw
vnealaaqk

Timeline for d1r9qa_:

• d1r9qa_ first appeared in SCOP 1.67
  
• d1r9qa_ appears in SCOPe 2.04
  
• d1r9qa_ appears in SCOPe 2.06
  
• d1r9qa_ appears in the current release, SCOPe 2.08