| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) ![]() conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures |
| Family c.23.16.1: Class I glutamine amidotransferases (GAT) [52318] (12 proteins) contains a catalytic Cys-His-Glu triad |
| Protein Hypothetical protein YaaE [102250] (4 species) glutamine amidotransferase of SNO/PDX2 family implicated in pyridoxine biosynthesis |
| Species Bacillus subtilis [TaxId:1423] [102251] (2 PDB entries) |
| Domain d1r9gb_: 1r9g B: [97259] |
PDB Entry: 1r9g (more details), 2.5 Å
SCOPe Domain Sequences for d1r9gb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1r9gb_ c.23.16.1 (B:) Hypothetical protein YaaE {Bacillus subtilis [TaxId: 1423]}
mltigvlglqgavrehihaieacgaaglvvkrpeqlnevdglilpggesttmrrlidtyq
fmeplrefaaqgkpmfgtcagliilakeiagsdnphlgllnvvvernsfgrqvdsfeadl
tikgldepftgvfiraphileagenvevlsehngrivaakqgqflgcsfhpeltedhrvt
qlfvemveeykqkalv
Timeline for d1r9gb_: