Lineage for d1r9ga_ (1r9g A:)
- Root: SCOP 1.67
Class c: Alpha and beta proteins (a/b) [51349] (130 folds) 
Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (5 families) 
conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures
Family c.23.16.1: Class I glutamine amidotransferases (GAT) [52318] (7 proteins)
contains a catalytic Cys-His-Glu triad
Protein Hypothetical protein YaaE [102250] (2 species)
glutamine amidotransferase of SNO/PDX2 family implicated in pyridoxine biosynthesis
Species Bacillus subtilis [TaxId:1423] [102251] (1 PDB entry) 
Domain d1r9ga_: 1r9g A: [97258]
Details for d1r9ga_
PDB Entry: 1r9g (more details), 2.5 Å
PDB Description: Three-dimensional Structure of YaaE from Bacillus subtilis
SCOP Domain Sequences for d1r9ga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1r9ga_ c.23.16.1 (A:) Hypothetical protein YaaE {Bacillus subtilis}
mltigvlglqgavrehihaieacgaaglvvkrpeqlnevdglilpggesttmrrlidtyq
fmeplrefaaqgkpmfgtcagliilakeiagsdnphlgllnvvvernsfgrqvdsfeadl
tikgldepftgvfiraphileagenvevlsehngrivaakqgqflgcsfhpeltedhrvt
qlfvemveeykqkalv
SCOP Domain Coordinates for d1r9ga_:
Click to download the PDB-style file with coordinates for d1r9ga_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1r9ga_:
- d1r9ga_ is new in SCOP 1.67
- d1r9ga_ appears in SCOP 1.69
- d1r9ga_ appears in the current release, SCOPe 2.08
View in 3D
