Lineage for d1r9fa_ (1r9f A:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 516762Fold d.255: Tombusvirus P19 core protein, VP19 [103144] (1 superfamily)
    beta(2)-alpha-beta(2)-alpha; 2 layers: alpha/beta; antiparallel sheet: order 2134
  4. 516763Superfamily d.255.1: Tombusvirus P19 core protein, VP19 [103145] (1 family) (S)
  5. 516764Family d.255.1.1: Tombusvirus P19 core protein, VP19 [103146] (1 protein)
  6. 516765Protein Tombusvirus P19 core protein, VP19 [103147] (2 species)
    an RNA silencing suppressor
  7. 516769Species Tomato bushy stunt virus, TBSV [TaxId:12145] [103148] (1 PDB entry)
  8. 516770Domain d1r9fa_: 1r9f A: [97257]
    complexed with siRNA

Details for d1r9fa_

PDB Entry: 1r9f (more details), 1.85 Å

PDB Description: crystal structure of p19 complexed with 19-bp small interfering rna

SCOP Domain Sequences for d1r9fa_:

Sequence, based on SEQRES records: (download)

>d1r9fa_ d.255.1.1 (A:) Tombusvirus P19 core protein, VP19 {Tomato bushy stunt virus, TBSV}
hmtspfklpdespswtewrlhndetnsnqdnplgfkeswgfgkvvfkrylrydrteaslh
rvlgswtgdsvnyaasrffgfdqigctysirfrgvsitvsggsrtlqhlcemairskqem
lqma

Sequence, based on observed residues (ATOM records): (download)

>d1r9fa_ d.255.1.1 (A:) Tombusvirus P19 core protein, VP19 {Tomato bushy stunt virus, TBSV}
hmtspfklpdespswtewrlhndetqdnplgfkeswgfgkvvfkrylrydrteaslhrvl
gswtgdsvnyaasrffgfdqigctysirfrgvsitvsggsrtlqhlcemairskqemlqm
a

SCOP Domain Coordinates for d1r9fa_:

Click to download the PDB-style file with coordinates for d1r9fa_.
(The format of our PDB-style files is described here.)

Timeline for d1r9fa_: